PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.A03094.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family ZF-HD
Protein Properties Length: 424aa    MW: 45567.9 Da    PI: 7.0924
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.A03094.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer90.71.3e-28166219358
     ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                     ++rY+eCl+NhAa+lG+h++DGC+Efmps g+   aaal CaACgCHR+FHRre +
  Pahal.A03094.1 166 QWRYRECLRNHAARLGAHVLDGCCEFMPSAGDG--AAALACAACGCHRSFHRREAV 219
                     789**************************6666..99****************976 PP

2Homeobox15.43.2e-05315370152
                     TT--SS--HHHHHHHHHHHH....HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFe....knrypsaeereeLAkklgLterqVkvWFqNrR 52 
                     +r Rt+ft++q +++ e+ +    + ++p+ ++     +++g++ r+ kvW +N +
  Pahal.A03094.1 315 KRFRTKFTADQKDRMREFAHrlgwRIHKPDSDAVDAFCAQVGVSRRVLKVWMHNNK 370
                     789***********987655888779****************************88 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047704.3E-25167218IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257744.0E-8168217IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015666.2E-23168217IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.765169217IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.601.4E-29305373IPR009057Homeodomain-like
SuperFamilySSF466897.28E-19307371IPR009057Homeodomain-like
TIGRFAMsTIGR015651.4E-26314370IPR006455Homeodomain, ZF-HD class
CDDcd000860.00699315368No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    Send to blast
MEYKRSSHVE EEQEEEEEEE EEDEEEEEEE DEDEARGHRY TTAAAAPIGA AQQQQVQAQA  60
LGLGSHASLM DAAAFSRPRL PPNCSLVTQP PLPPPGFMPT QRQPQLHPRR AERERERAAG  120
APQPQPRRHQ EGARNGVLGG GNVPPQASTL ALATGAGAVG PVEAAQWRYR ECLRNHAARL  180
GAHVLDGCCE FMPSAGDGAA ALACAACGCH RSFHRREAVP GVAAAAVAVS PSPTTPTASS  240
SRVMPLLLAP PHMQTRPHVP VSPSSAPAAL TESSSEELRG PVAAAAHPGP PTPLPPHAQL  300
AVGGSASAPP APSKKRFRTK FTADQKDRMR EFAHRLGWRI HKPDSDAVDA FCAQVGVSRR  360
VLKVWMHNNK HLAKIPPSPP SSQPPQQQPP HHRDHQPPPP PHHIHLHHPP PPPPQQQQQQ  420
HDA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-213133821679ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953622.11e-149PREDICTED: zinc-finger homeodomain protein 7-like
SwissprotQ8S3Q91e-86ZHD7_ORYSJ; Zinc-finger homeodomain protein 7
TrEMBLK3Z1101e-149K3Z110_SETIT; Uncharacterized protein
STRINGSi020227m1e-148(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP134912329
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50890.14e-26homeobox protein 28